Lineage for d2weca_ (2wec A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2799129Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 2799130Superfamily b.50.1: Acid proteases [50630] (4 families) (S)
  5. 2800798Family b.50.1.2: Pepsin-like [50646] (11 proteins)
    duplication: consists of two similar barrel domains
    N-terminal: barrel, partly opened; n*=6, S*=10
  6. 2800799Protein Acid protease [50649] (9 species)
  7. 2800829Species Fungus (Penicillium janthinellum), penicillopepsin [TaxId:5079] [50650] (14 PDB entries)
  8. 2800835Domain d2weca_: 2wec A: [26808]
    complexed with man, pp5, so4

Details for d2weca_

PDB Entry: 2wec (more details), 1.5 Å

PDB Description: acid proteinase (penicillopepsin) (e.c.3.4.23.20) complex with phosphonate inhibitor: methyl(2s)-[1-(((n-(1-naphthaleneacetyl))-l- valyl)aminomethyl)hydroxy phosphinyloxy]-3-phenylpropanoate, sodium salt
PDB Compounds: (A:) penicillopepsin

SCOPe Domain Sequences for d2weca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2weca_ b.50.1.2 (A:) Acid protease {Fungus (Penicillium janthinellum), penicillopepsin [TaxId: 5079]}
aasgvatntptandeeyitpvtiggttlnlnfdtgsadlwvfstelpasqqsghsvynps
atgkelsgytwsisygdgssasgnvftdsvtvggvtahgqavqaaqqisaqfqqdtnndg
llglafssintvqpqsqttffdtvksslaqplfavalkhqqpgvydfgfidsskytgslt
ytgvdnsqgfwsfnvdsytagsqsgdgfsgiadtgttllllddsvvsqyysqvsgaqqds
naggyvfdcstnlpdfsvsisgytatvpgslinygpsgdgstclggiqsnsgigfsifgd
iflksqyvvfdsdgpqlgfapqa

SCOPe Domain Coordinates for d2weca_:

Click to download the PDB-style file with coordinates for d2weca_.
(The format of our PDB-style files is described here.)

Timeline for d2weca_: