Lineage for d3wihl2 (3wih L:108-213)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2749859Protein automated matches [190374] (15 species)
    not a true protein
  7. 2752318Species Mouse (Mus musculus) [TaxId:10090] [224855] (650 PDB entries)
  8. 2752482Domain d3wihl2: 3wih L:108-213 [268079]
    Other proteins in same PDB: d3wiha_, d3wihb_, d3wihh_, d3wihi_, d3wihl1, d3wihm1
    automated match to d2v7ha2
    complexed with gol

Details for d3wihl2

PDB Entry: 3wih (more details), 1.7 Å

PDB Description: crystal structure of the third fibronectin domain (fn3) of human robo1 in complex with the fab fragment of murine monoclonal antibody b2212a.
PDB Compounds: (L:) anti-human ROBO1 antibody B2212A Fab light chain

SCOPe Domain Sequences for d3wihl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3wihl2 b.1.1.2 (L:108-213) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
raeaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrne

SCOPe Domain Coordinates for d3wihl2:

Click to download the PDB-style file with coordinates for d3wihl2.
(The format of our PDB-style files is described here.)

Timeline for d3wihl2: