Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) duplication contains two domains of this fold |
Family c.55.1.0: automated matches [227137] (1 protein) not a true family |
Protein automated matches [226839] (52 species) not a true protein |
Species Trypanosoma brucei [TaxId:31285] [268052] (8 PDB entries) |
Domain d3wxia1: 3wxi A:1-262 [268070] Other proteins in same PDB: d3wxia3, d3wxib3 automated match to d3h3oc1 |
PDB Entry: 3wxi (more details), 2.9 Å
SCOPe Domain Sequences for d3wxia1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3wxia1 c.55.1.0 (A:1-262) automated matches {Trypanosoma brucei [TaxId: 31285]} mkyvgsidqgttstrfiifderqrpvsvhqvphtqhtphpgwlehdpmeifrsackcmsv aiaklrqkdasfrkieaigitnqrettvawdrvtkeplcyapvwndlrtyditkkvtael gggdsmfaskitglpvstyfaafkmrwmlenvpavadacrrgtlcfgtidtwlmyklsgg kafvtdvtnasrtflmdlrtrkwspelceklkipmetlpeirsnselfgyvetdecgvaa alnertpimgsigdqqsalfgn
Timeline for d3wxia1: