SCOPe 2.06: Domain d3wxia1: 3wxi A:1-262

Lineage for d3wxia1 (3wxi A:1-262)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families)
   duplication contains two domains of this fold

5. Family c.55.1.0: automated matches [227137] (1 protein)
   not a true family

6. Protein automated matches [226839] (52 species)
   not a true protein

7. Species Trypanosoma brucei [TaxId:31285] [268052] (8 PDB entries)

8. Domain d3wxia1: 3wxi A:1-262 [268070]
   Other proteins in same PDB: d3wxia3, d3wxib3
   automated match to d3h3oc1

Details for d3wxia1

PDB Entry: 3wxi, 2.9 Å

PDB Description: Crystal structure of trypanosoma brucei gambiense glycerol kinase (ligand-free form)

PDB Compounds: (A:) glycerol kinase

SCOPe Domain Sequences for d3wxia1:

Sequence; same for both SEQRES and ATOM records:

>d3wxia1 c.55.1.0 (A:1-262) automated matches {Trypanosoma brucei [TaxId: 31285]}
mkyvgsidqgttstrfiifderqrpvsvhqvphtqhtphpgwlehdpmeifrsackcmsv
aiaklrqkdasfrkieaigitnqrettvawdrvtkeplcyapvwndlrtyditkkvtael
gggdsmfaskitglpvstyfaafkmrwmlenvpavadacrrgtlcfgtidtwlmyklsgg
kafvtdvtnasrtflmdlrtrkwspelceklkipmetlpeirsnselfgyvetdecgvaa
alnertpimgsigdqqsalfgn

Timeline for d3wxia1:

• d3wxia1 first appeared in SCOPe 2.05
  
• d3wxia1 appears in SCOPe 2.07
  
• d3wxia1 appears in the current release, SCOPe 2.08