Lineage for d3wxka2 (3wxk A:263-511)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2883383Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2883384Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 2884835Family c.55.1.0: automated matches [227137] (1 protein)
    not a true family
  6. 2884836Protein automated matches [226839] (64 species)
    not a true protein
  7. 2885651Species Trypanosoma brucei [TaxId:31285] [268052] (13 PDB entries)
  8. 2885661Domain d3wxka2: 3wxk A:263-511 [268062]
    Other proteins in same PDB: d3wxka3, d3wxkb3, d3wxkc3, d3wxkd3
    automated match to d3h46o2
    complexed with gol, hez

Details for d3wxka2

PDB Entry: 3wxk (more details), 2.37 Å

PDB Description: Crystal structure of trypanosoma brucei gambiense glycerol kinase in complex with glycerol
PDB Compounds: (A:) glycerol kinase

SCOPe Domain Sequences for d3wxka2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3wxka2 c.55.1.0 (A:263-511) automated matches {Trypanosoma brucei [TaxId: 31285]}
mcfekgeakntygtgcfllmnvgeearfskhgllstvgfqvgrdgpcyyalegaiacaga
tvewmrrnmnlfshiteceklarsvpgtqgivfvpafsgllapywdpsargtivgmtlkt
trahviraalqaialqlndvvgsmkrdaglnlsslrvdgglskngllmeiqasllgvdil
vpsmhettalgaalcaglaagvwtsleevkavsrrenswktvspsgsamereamiaewre
alkrtkwak

SCOPe Domain Coordinates for d3wxka2:

Click to download the PDB-style file with coordinates for d3wxka2.
(The format of our PDB-style files is described here.)

Timeline for d3wxka2: