Lineage for d2wea__ (2wea -)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 562942Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 562943Superfamily b.50.1: Acid proteases [50630] (2 families) (S)
  5. 563392Family b.50.1.2: Pepsin-like [50646] (10 proteins)
    duplication: consists of two similar barrel domains
    N-terminal: barrel, partly opened; n*=6, S*=10
  6. 563393Protein Acid protease [50649] (9 species)
  7. 563422Species Fungus (Penicillium janthinellum), penicillopepsin [TaxId:5079] [50650] (14 PDB entries)
  8. 563424Domain d2wea__: 2wea - [26806]
    complexed with man, pp6, so4

Details for d2wea__

PDB Entry: 2wea (more details), 1.25 Å

PDB Description: acid proteinase (penicillopepsin) (e.c.3.4.23.20) complex with phosphonate inhibitor: methyl[cyclo-7[(2r)-((n-valyl) amino)-2- (hydroxyl-(1s)-1-methyoxycarbonyl-2-phenylethoxy) phosphinyloxy- ethyl]-1-naphthaleneacetamide], sodium salt

SCOP Domain Sequences for d2wea__:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wea__ b.50.1.2 (-) Acid protease {Fungus (Penicillium janthinellum), penicillopepsin}
aasgvatntptandeeyitpvtiggttlnlnfdtgsadlwvfstelpasqqsghsvynps
atgkelsgytwsisygdgssasgnvftdsvtvggvtahgqavqaaqqisaqfqqdtnndg
llglafssintvqpqsqttffdtvksslaqplfavalkhqqpgvydfgfidsskytgslt
ytgvdnsqgfwsfnvdsytagsqsgdgfsgiadtgttllllddsvvsqyysqvsgaqqds
naggyvfdcstnlpdfsvsisgytatvpgslinygpsgdgstclggiqsnsgigfsifgd
iflksqyvvfdsdgpqlgfapqa

SCOP Domain Coordinates for d2wea__:

Click to download the PDB-style file with coordinates for d2wea__.
(The format of our PDB-style files is described here.)

Timeline for d2wea__: