Lineage for d2wea__ (2wea -)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.50: Acid proteases [50629] (1 superfamily) Superfamily b.50.1: Acid proteases [50630] (2 families) 
Family b.50.1.2: Pepsin-like [50646] (9 proteins) Protein Acid protease [50649] (5 species) Species Fungus (Penicillium janthinellum), penicillopepsin [TaxId:5079] [50650] (14 PDB entries) 
Domain d2wea__: 2wea - [26806]
Details for d2wea__
PDB Entry: 2wea (more details), 1.25 Å
PDB Description: acid proteinase (penicillopepsin) (e.c.3.4.23.20) complex with phosphonate inhibitor: methyl[cyclo-7[(2r)-((n-valyl) amino)-2- (hydroxyl-(1s)-1-methyoxycarbonyl-2-phenylethoxy) phosphinyloxy- ethyl]-1-naphthaleneacetamide], sodium salt
SCOP Domain Sequences for d2wea__:
Sequence; same for both SEQRES and ATOM records: (download)
>d2wea__ b.50.1.2 (-) Acid protease {Fungus (Penicillium janthinellum), penicillopepsin}
aasgvatntptandeeyitpvtiggttlnlnfdtgsadlwvfstelpasqqsghsvynps
atgkelsgytwsisygdgssasgnvftdsvtvggvtahgqavqaaqqisaqfqqdtnndg
llglafssintvqpqsqttffdtvksslaqplfavalkhqqpgvydfgfidsskytgslt
ytgvdnsqgfwsfnvdsytagsqsgdgfsgiadtgttllllddsvvsqyysqvsgaqqds
naggyvfdcstnlpdfsvsisgytatvpgslinygpsgdgstclggiqsnsgigfsifgd
iflksqyvvfdsdgpqlgfapqa
SCOP Domain Coordinates for d2wea__:
Click to download the PDB-style file with coordinates for d2wea__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2wea__:
- d2wea__ appears in SCOP 1.57
- d2wea__ appears in the current release, SCOPe 2.08, called d2weaa_
View in 3D