| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) ![]() duplication contains two domains of this fold |
| Family c.55.1.0: automated matches [227137] (1 protein) not a true family |
| Protein automated matches [226839] (63 species) not a true protein |
| Species Trypanosoma brucei [TaxId:31285] [268052] (13 PDB entries) |
| Domain d3wxkc1: 3wxk C:1-262 [268056] Other proteins in same PDB: d3wxka3, d3wxkb3, d3wxkc3, d3wxkd3 automated match to d3h3oc1 complexed with gol, hez |
PDB Entry: 3wxk (more details), 2.37 Å
SCOPe Domain Sequences for d3wxkc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3wxkc1 c.55.1.0 (C:1-262) automated matches {Trypanosoma brucei [TaxId: 31285]}
mkyvgsidqgttstrfiifderqrpvsvhqvphtqhtphpgwlehdpmeifrsackcmsv
aiaklrqkdasfrkieaigitnqrettvawdrvtkeplcyapvwndlrtyditkkvtael
gggdsmfaskitglpvstyfaafkmrwmlenvpavadacrrgtlcfgtidtwlmyklsgg
kafvtdvtnasrtflmdlrtrkwspelceklkipmetlpeirsnselfgyvetdecgvaa
alnertpimgsigdqqsalfgn
Timeline for d3wxkc1: