Lineage for d3wvma_ (3wvm A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2804246Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 2804247Superfamily b.60.1: Lipocalins [50814] (10 families) (S)
    bind hydrophobic ligands in their interior
  5. 2804862Family b.60.1.2: Fatty acid binding protein-like [50847] (18 proteins)
    ten-stranded meander beta-sheet folded upon itself
    relates to the common fold by opening the barrel and insertion of beta-hairpin
  6. 2805192Protein Muscle fatty acid binding protein (m-fabp) [50848] (2 species)
  7. 2805195Species Human (Homo sapiens) [TaxId:9606] [50849] (22 PDB entries)
  8. 2805196Domain d3wvma_: 3wvm A: [268050]
    automated match to d3wxqa_
    complexed with p6g, ste

Details for d3wvma_

PDB Entry: 3wvm (more details), 0.88 Å

PDB Description: the 0.88 angstrom x-ray structure of the human heart fatty acid- binding protein complexed with stearic acid
PDB Compounds: (A:) Fatty acid-binding protein, heart

SCOPe Domain Sequences for d3wvma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3wvma_ b.60.1.2 (A:) Muscle fatty acid binding protein (m-fabp) {Human (Homo sapiens) [TaxId: 9606]}
mvdaflgtwklvdsknfddymkslgvgfatrqvasmtkpttiiekngdiltlkthstfkn
teisfklgvefdettaddrkvksivtldggklvhlqkwdgqettlvrelidgkliltlth
gtavctrtyekea

SCOPe Domain Coordinates for d3wvma_:

Click to download the PDB-style file with coordinates for d3wvma_.
(The format of our PDB-style files is described here.)

Timeline for d3wvma_: