Lineage for d1bxoa_ (1bxo A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2058814Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 2058815Superfamily b.50.1: Acid proteases [50630] (4 families) (S)
  5. 2060177Family b.50.1.2: Pepsin-like [50646] (11 protein domains)
    duplication: consists of two similar barrel domains
    N-terminal: barrel, partly opened; n*=6, S*=10
  6. 2060178Protein Acid protease [50649] (9 species)
  7. 2060208Species Fungus (Penicillium janthinellum), penicillopepsin [TaxId:5079] [50650] (14 PDB entries)
  8. 2060209Domain d1bxoa_: 1bxo A: [26805]
    complexed with gol, man, pp7, so4

Details for d1bxoa_

PDB Entry: 1bxo (more details), 0.95 Å

PDB Description: acid proteinase (penicillopepsin) (e.c.3.4.23.20) complex with phosphonate inhibitor: methyl cyclo[(2s)-2-[[(1r)-1-(n-(l-n-(3-methylbutanoyl)valyl-l-aspartyl)amino)-3-methylbut yl] hydroxyphosphinyloxy]-3-(3-aminomethyl) phenylpropanoate
PDB Compounds: (A:) protein (penicillopepsin)

SCOPe Domain Sequences for d1bxoa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bxoa_ b.50.1.2 (A:) Acid protease {Fungus (Penicillium janthinellum), penicillopepsin [TaxId: 5079]}
aasgvatntptandeeyitpvtiggttlnlnfdtgsadlwvfstelpasqqsghsvynps
atgkelsgytwsisygdgssasgnvftdsvtvggvtahgqavqaaqqisaqfqqdtnndg
llglafssintvqpqsqttffdtvksslaqplfavalkhqqpgvydfgfidsskytgslt
ytgvdnsqgfwsfnvdsytagsqsgdgfsgiadtgttllllddsvvsqyysqvsgaqqds
naggyvfdcstnlpdfsvsisgytatvpgslinygpsgdgstclggiqsnsgigfsifgd
iflksqyvvfdsdgpqlgfapqa

SCOPe Domain Coordinates for d1bxoa_:

Click to download the PDB-style file with coordinates for d1bxoa_.
(The format of our PDB-style files is described here.)

Timeline for d1bxoa_: