Class a: All alpha proteins [46456] (286 folds) |
Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (10 families) contains bimetal-ion centre in the middle of the bundle |
Family a.25.1.0: automated matches [191307] (1 protein) not a true family |
Protein automated matches [190036] (33 species) not a true protein |
Species Mus musculus [TaxId:10090] [268023] (1 PDB entry) |
Domain d3wnwi_: 3wnw I: [268046] automated match to d3vnxa_ complexed with fe, gol, k, mg |
PDB Entry: 3wnw (more details), 2.24 Å
SCOPe Domain Sequences for d3wnwi_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3wnwi_ a.25.1.0 (I:) automated matches {Mus musculus [TaxId: 10090]} spsqvrqnyhqdaeaainrqinlelyasyvylsmscyfdrddvalknfakyflhqsheer ehaeklmklqnqrggriflqdikkpdrddwesglnamecalhleksvnqsllelhklatd kndphlcdfietyylseqvksikelgdhvtnlrkmgapeagmaeylfdkhtlg
Timeline for d3wnwi_: