| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (10 families) ![]() contains bimetal-ion centre in the middle of the bundle |
| Family a.25.1.0: automated matches [191307] (1 protein) not a true family |
| Protein automated matches [190036] (60 species) not a true protein |
| Species Mouse (Mus musculus) [TaxId:10090] [268023] (2 PDB entries) |
| Domain d3wnwd_: 3wnw D: [268043] automated match to d3vnxa_ complexed with fe, gol, k, mg |
PDB Entry: 3wnw (more details), 2.24 Å
SCOPe Domain Sequences for d3wnwd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3wnwd_ a.25.1.0 (D:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
spsqvrqnyhqdaeaainrqinlelyasyvylsmscyfdrddvalknfakyflhqsheer
ehaeklmklqnqrggriflqdikkpdrddwesglnamecalhleksvnqsllelhklatd
kndphlcdfietyylseqvksikelgdhvtnlrkmgapeagmaeylfdkhtlg
Timeline for d3wnwd_: