Lineage for d3wnwa_ (3wnw A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2700837Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2700838Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2703895Family a.25.1.0: automated matches [191307] (1 protein)
    not a true family
  6. 2703896Protein automated matches [190036] (60 species)
    not a true protein
  7. 2704288Species Mouse (Mus musculus) [TaxId:10090] [268023] (2 PDB entries)
  8. 2704290Domain d3wnwa_: 3wnw A: [268042]
    automated match to d3vnxa_
    complexed with fe, gol, k, mg

Details for d3wnwa_

PDB Entry: 3wnw (more details), 2.24 Å

PDB Description: Structure of Mouse H-chain modified ferritin
PDB Compounds: (A:) ferritin heavy chain

SCOPe Domain Sequences for d3wnwa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3wnwa_ a.25.1.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
spsqvrqnyhqdaeaainrqinlelyasyvylsmscyfdrddvalknfakyflhqsheer
ehaeklmklqnqrggriflqdikkpdrddwesglnamecalhleksvnqsllelhklatd
kndphlcdfietyylseqvksikelgdhvtnlrkmgapeagmaeylfdkhtlg

SCOPe Domain Coordinates for d3wnwa_:

Click to download the PDB-style file with coordinates for d3wnwa_.
(The format of our PDB-style files is described here.)

Timeline for d3wnwa_: