SCOPe 2.05: Domain d1e81e_: 1e81 E:

Lineage for d1e81e_ (1e81 E:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.50: Acid proteases [50629] (1 superfamily)
   barrel, closed; n=6, S=10, complex topology

4. Superfamily b.50.1: Acid proteases [50630] (4 families)

5. Family b.50.1.2: Pepsin-like [50646] (11 proteins)
   duplication: consists of two similar barrel domains
   N-terminal: barrel, partly opened; n*=6, S*=10

6. Protein Endothiapepsin [50647] (1 species)

7. Species Chestnut blight fungus (Endothia parasitica) [TaxId:5116] [50648] (51 PDB entries)

8. Domain d1e81e_: 1e81 E: [26803]
   complexed with m91

Details for d1e81e_

PDB Entry: 1e81, 2.05 Å

PDB Description: endothiapepsin complex with renin inhibitor merck-kgaa-emd61395

PDB Compounds: (E:) endothiapepsin

SCOPe Domain Sequences for d1e81e_:

Sequence; same for both SEQRES and ATOM records:

>d1e81e_ b.50.1.2 (E:) Endothiapepsin {Chestnut blight fungus (Endothia parasitica) [TaxId: 5116]}
stgsatttpidslddayitpvqigtpaqtlnldfdtgssdlwvfssettasevdgqtiyt
psksttakllsgatwsisygdgssssgdvytdtvsvggltvtgqavesakkvsssfteds
tidgllglafstlntvsptqqktffdnakasldspvftadlgyhapgtynfgfidttayt
gsitytavstkqgfwewtstgyavgsgtfkstsidgiadtgttllylpatvvsaywaqvs
gakssssvggyvfpcsatlpsftfgvgsarivipgdyidfgpistgssscfggiqssagi
ginifgdvalkaafvvfngattptlgfask

Timeline for d1e81e_:

• d1e81e_ first appeared (with stable ids) in SCOP 1.55
  
• d1e81e_ appears in SCOPe 2.04
  
• d1e81e_ appears in SCOPe 2.06
  
• d1e81e_ appears in the current release, SCOPe 2.08