Lineage for d3wiha_ (3wih A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2761681Superfamily b.1.2: Fibronectin type III [49265] (2 families) (S)
  5. 2762239Family b.1.2.0: automated matches [191562] (1 protein)
    not a true family
  6. 2762240Protein automated matches [190976] (5 species)
    not a true protein
  7. 2762264Species Human (Homo sapiens) [TaxId:9606] [188649] (69 PDB entries)
  8. 2762284Domain d3wiha_: 3wih A: [268021]
    Other proteins in same PDB: d3wihh_, d3wihi_, d3wihl1, d3wihl2, d3wihm1, d3wihm2
    automated match to d4n5ua_
    complexed with gol

Details for d3wiha_

PDB Entry: 3wih (more details), 1.7 Å

PDB Description: crystal structure of the third fibronectin domain (fn3) of human robo1 in complex with the fab fragment of murine monoclonal antibody b2212a.
PDB Compounds: (A:) roundabout homolog 1

SCOPe Domain Sequences for d3wiha_:

Sequence, based on SEQRES records: (download)

>d3wiha_ b.1.2.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
appqgvtvskndgngtailvswqpppedtqngmvqeykvwclgnetryhinktvdgstfs
vvipflvpgirysvevaastgagsgvksepqfiqld

Sequence, based on observed residues (ATOM records): (download)

>d3wiha_ b.1.2.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
appqgvtvskndgngtailvswqpppemvqeykvwclgnetryhinktvdgstfsvvipf
lvpgirysvevaasgsgvksepqfiqld

SCOPe Domain Coordinates for d3wiha_:

Click to download the PDB-style file with coordinates for d3wiha_.
(The format of our PDB-style files is described here.)

Timeline for d3wiha_: