Lineage for d2muma_ (2mum A:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3037862Fold g.50: FYVE/PHD zinc finger [57902] (2 superfamilies)
    dimetal(zinc)-bound alpha+beta fold
  4. 3037863Superfamily g.50.1: FYVE/PHD zinc finger [57903] (4 families) (S)
  5. 3037962Family g.50.1.0: automated matches [191482] (1 protein)
    not a true family
  6. 3037963Protein automated matches [190772] (6 species)
    not a true protein
  7. 3037966Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [268019] (1 PDB entry)
  8. 3037967Domain d2muma_: 2mum A: [268020]
    automated match to d2pnxa1
    complexed with zn

Details for d2muma_

PDB Entry: 2mum (more details)

PDB Description: Solution structure of the PHD domain of Yeast YNG2
PDB Compounds: (A:) Chromatin modification-related protein YNG2

SCOPe Domain Sequences for d2muma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2muma_ g.50.1.0 (A:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
tlycfcqrvsfgemvacdgpnckyewfhydcvnlkeppkgtwycpeckie

SCOPe Domain Coordinates for d2muma_:

Click to download the PDB-style file with coordinates for d2muma_.
(The format of our PDB-style files is described here.)

Timeline for d2muma_: