| Class g: Small proteins [56992] (100 folds) |
| Fold g.50: FYVE/PHD zinc finger [57902] (2 superfamilies) dimetal(zinc)-bound alpha+beta fold |
Superfamily g.50.1: FYVE/PHD zinc finger [57903] (4 families) ![]() |
| Family g.50.1.0: automated matches [191482] (1 protein) not a true family |
| Protein automated matches [190772] (6 species) not a true protein |
| Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [268019] (1 PDB entry) |
| Domain d2muma_: 2mum A: [268020] automated match to d2pnxa1 complexed with zn |
PDB Entry: 2mum (more details)
SCOPe Domain Sequences for d2muma_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2muma_ g.50.1.0 (A:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
tlycfcqrvsfgemvacdgpnckyewfhydcvnlkeppkgtwycpeckie
Timeline for d2muma_: