Lineage for d1e80e_ (1e80 E:)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. Superfamily b.50.1: Acid proteases [50630] (4 families) (S)
  5. Family b.50.1.2: Pepsin-like [50646] (11 proteins)
    duplication: consists of two similar barrel domains
    N-terminal: barrel, partly opened; n*=6, S*=10
  6. Protein Endothiapepsin [50647] (1 species)
  7. Species Chestnut blight fungus (Endothia parasitica) [TaxId:5116] [50648] (538 PDB entries)
  8. Domain d1e80e_: 1e80 E: [26802]
    complexed with 0gq

Details for d1e80e_

PDB Entry: 1e80 (more details), 2.05 Å

PDB Description: endothiapepsin complex with renin inhibitor merck-kgaa-emd56133
PDB Compounds: (E:) endothiapepsin

SCOPe Domain Sequences for d1e80e_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e80e_ b.50.1.2 (E:) Endothiapepsin {Chestnut blight fungus (Endothia parasitica) [TaxId: 5116]}
stgsatttpidslddayitpvqigtpaqtlnldfdtgssdlwvfssettasevdgqtiyt
psksttakllsgatwsisygdgssssgdvytdtvsvggltvtgqavesakkvsssfteds
tidgllglafstlntvsptqqktffdnakasldspvftadlgyhapgtynfgfidttayt
gsitytavstkqgfwewtstgyavgsgtfkstsidgiadtgttllylpatvvsaywaqvs
gakssssvggyvfpcsatlpsftfgvgsarivipgdyidfgpistgssscfggiqssagi
ginifgdvalkaafvvfngattptlgfask

SCOPe Domain Coordinates for d1e80e_ are not available.

Timeline for d1e80e_: