Lineage for d2mr8a1 (2mr8 A:4-81)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2706108Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
    4 helices, bundle; helix 3 is shorter than others; up-and-down
  4. 2706109Superfamily a.28.1: ACP-like [47336] (4 families) (S)
  5. 2706248Family a.28.1.0: automated matches [191582] (1 protein)
    not a true family
  6. 2706249Protein automated matches [191038] (29 species)
    not a true protein
  7. 2706250Species Actinoplanes teichomyceticus [TaxId:1867] [268016] (2 PDB entries)
  8. 2706252Domain d2mr8a1: 2mr8 A:4-81 [268018]
    Other proteins in same PDB: d2mr8a2, d2mr8a3
    automated match to d2gdwa_

Details for d2mr8a1

PDB Entry: 2mr8 (more details)

PDB Description: holo structure of the peptidyl carrier protein domain 7 of the teicoplanin producing non-ribosomal peptide synthetase
PDB Compounds: (A:) Non-ribosomal peptide synthetase

SCOPe Domain Sequences for d2mr8a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2mr8a1 a.28.1.0 (A:4-81) automated matches {Actinoplanes teichomyceticus [TaxId: 1867]}
akapesatekvlcalyaeilgvervgvddafhdlggssalamrliarireelgvdlpirq
lfssptpagvaralaaks

SCOPe Domain Coordinates for d2mr8a1:

Click to download the PDB-style file with coordinates for d2mr8a1.
(The format of our PDB-style files is described here.)

Timeline for d2mr8a1: