SCOPe 2.08: Domain d2m8ua1: 2m8u A:4-77

Lineage for d2m8ua1 (2m8u A:4-77)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (12 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.0: automated matches [191396] (1 protein)
   not a true family

6. Protein automated matches [190513] (36 species)
   not a true protein

7. Species Slime mold (Dictyostelium discoideum) [TaxId:44689] [268014] (1 PDB entry)

8. Domain d2m8ua1: 2m8u A:4-77 [268015]
   Other proteins in same PDB: d2m8ua2
   automated match to d1n0yb_

Details for d2m8ua1

PDB Entry: 2m8u

PDB Description: solution structure of the dictyostelium discodieum myosin light chain, mlcc

PDB Compounds: (A:) Myosin Light Chain, MlcC

SCOPe Domain Sequences for d2m8ua1:

Sequence; same for both SEQRES and ATOM records:

>d2m8ua1 a.39.1.0 (A:4-77) automated matches {Slime mold (Dictyostelium discoideum) [TaxId: 44689]}
mnhintkaqvieafkvfdrdgngyvtvdylrkvlnelgdmmpadeieemiyeadpqnsgy
vqyetfvgmlflwd

Timeline for d2m8ua1:

• d2m8ua1 first appeared in SCOPe 2.05, called d2m8ua_
  
• d2m8ua1 appears in SCOPe 2.07