Lineage for d1epre_ (1epr E:)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 377363Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 377364Superfamily b.50.1: Acid proteases [50630] (2 families) (S)
  5. 377776Family b.50.1.2: Pepsin-like [50646] (9 proteins)
    duplication: consists of two similar barrel domains
    N-terminal: barrel, partly opened; n*=6, S*=10
  6. 377868Protein Endothiapepsin [50647] (1 species)
  7. 377869Species Chestnut blight fungus (Endothia parasitica) [TaxId:5116] [50648] (35 PDB entries)
  8. 377902Domain d1epre_: 1epr E: [26800]
    complexed with chf, dph, emr, tsm

Details for d1epre_

PDB Entry: 1epr (more details), 2.3 Å

PDB Description: endothia aspartic proteinase (endothiapepsin) complexed with pd-135, 040

SCOP Domain Sequences for d1epre_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1epre_ b.50.1.2 (E:) Endothiapepsin {Chestnut blight fungus (Endothia parasitica)}
stgsatttpidslddayitpvqigtpaqtlnldfdtgssdlwvfssettasevdgqtiyt
psksttakllsgatwsisygdgssssgdvytdtvsvggltvtgqavesakkvsssfteds
tidgllglafstlntvsptqqktffdnakasldspvftadlgyhapgtynfgfidttayt
gsitytavstkqgfwewtstgyavgsgtfkstsidgiadtgttllylpatvvsaywaqvs
gakssssvggyvfpcsatlpsftfgvgsarivipgdyidfgpistgssscfggiqssagi
ginifgdvalkaafvvfngattptlgfask

SCOP Domain Coordinates for d1epre_:

Click to download the PDB-style file with coordinates for d1epre_.
(The format of our PDB-style files is described here.)

Timeline for d1epre_: