SCOP 1.67: Domain d5er1e_: 5er1 E:

Lineage for d5er1e_ (5er1 E:)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.50: Acid proteases [50629] (1 superfamily)
   barrel, closed; n=6, S=10, complex topology

4. Superfamily b.50.1: Acid proteases [50630] (2 families)

5. Family b.50.1.2: Pepsin-like [50646] (9 proteins)
   duplication: consists of two similar barrel domains
   N-terminal: barrel, partly opened; n*=6, S*=10

6. Protein Endothiapepsin [50647] (1 species)

7. Species Chestnut blight fungus (Endothia parasitica) [TaxId:5116] [50648] (35 PDB entries)

8. Domain d5er1e_: 5er1 E: [26796]
   complexed with ch2, lol, ome

Details for d5er1e_

PDB Entry: 5er1, 2 Å

PDB Description: a rational approach to the design of antihypertensives. x-ray studies of complexes between aspartic proteinases and aminoalcohol renin inhibitors

SCOP Domain Sequences for d5er1e_:

Sequence; same for both SEQRES and ATOM records:

>d5er1e_ b.50.1.2 (E:) Endothiapepsin {Chestnut blight fungus (Endothia parasitica)}
stgsatttpidslddayitpvqigtpaqtlnldfdtgssdlwvfssettasevdgqtiyt
psksttakllsgatwsisygdgssssgdvytdtvsvggltvtgqavesakkvsssfteds
tidgllglafstlntvsptqqktffdnakasldspvftadlgyhapgtynfgfidttayt
gsitytavstkqgfwewtstgyavgsgtfkstsidgiadtgttllylpatvvsaywaqvs
gakssssvggyvfpcsatlpsftfgvgsarivipgdyidfgpistgssscfggiqssagi
ginifgdvalkaafvvfngattptlgfask

Timeline for d5er1e_:

• d5er1e_ first appeared (with stable ids) in SCOP 1.55
  
• d5er1e_ appears in SCOP 1.65
  
• d5er1e_ appears in SCOP 1.69
  
• d5er1e_ appears in the current release, SCOPe 2.08