Lineage for d1eple_ (1epl E:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 15694Fold b.50: Acid proteases [50629] (1 superfamily)
  4. 15695Superfamily b.50.1: Acid proteases [50630] (2 families) (S)
  5. 15989Family b.50.1.2: Pepsin-like [50646] (9 proteins)
  6. 16059Protein Endothiapepsin [50647] (1 species)
  7. 16060Species Chestnut blight fungus (Endothia parasitica) [TaxId:5116] [50648] (26 PDB entries)
  8. 16075Domain d1eple_: 1epl E: [26794]

Details for d1eple_

PDB Entry: 1epl (more details), 2 Å

PDB Description: a structural comparison of 21 inhibitor complexes of the aspartic proteinase from endothia parasitica

SCOP Domain Sequences for d1eple_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eple_ b.50.1.2 (E:) Endothiapepsin {Chestnut blight fungus (Endothia parasitica)}
stgsatttpidslddayitpvqigtpaqtlnldfdtgssdlwvfssettasevdgqtiyt
psksttakllsgatwsisygdgssssgdvytdtvsvggltvtgqavesakkvsssfteds
tidgllglafstlntvsptqqktffdnakasldspvftadlgyhapgtynfgfidttayt
gsitytavstkqgfwewtstgyavgsgtfkstsidgiadtgttllylpatvvsaywaqvs
gakssssvggyvfpcsatlpsftfgvgsarivipgdyidfgpistgssscfggiqssagi
ginifgdvalkaafvvfngattptlgfask

SCOP Domain Coordinates for d1eple_:

Click to download the PDB-style file with coordinates for d1eple_.
(The format of our PDB-style files is described here.)

Timeline for d1eple_: