SCOPe 2.06: Domain d1epoe_: 1epo E:

Lineage for d1epoe_ (1epo E:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.50: Acid proteases [50629] (1 superfamily)
   barrel, closed; n=6, S=10, complex topology

4. Superfamily b.50.1: Acid proteases [50630] (4 families)

5. Family b.50.1.2: Pepsin-like [50646] (11 proteins)
   duplication: consists of two similar barrel domains
   N-terminal: barrel, partly opened; n*=6, S*=10

6. Protein Endothiapepsin [50647] (1 species)

7. Species Chestnut blight fungus (Endothia parasitica) [TaxId:5116] [50648] (507 PDB entries)

8. Domain d1epoe_: 1epo E: [26790]
   complexed with 2z3

Details for d1epoe_

PDB Entry: 1epo, 2 Å

PDB Description: endothia aspartic proteinase (endothiapepsin) complexed with cp-81,282 (mor phe nle chf nme)

PDB Compounds: (E:) endothiapepsin

SCOPe Domain Sequences for d1epoe_:

Sequence; same for both SEQRES and ATOM records:

>d1epoe_ b.50.1.2 (E:) Endothiapepsin {Chestnut blight fungus (Endothia parasitica) [TaxId: 5116]}
stgsatttpidslddayitpvqigtpaqtlnldfdtgssdlwvfssettasevdgqtiyt
psksttakllsgatwsisygdgssssgdvytdtvsvggltvtgqavesakkvsssfteds
tidgllglafstlntvsptqqktffdnakasldspvftadlgyhapgtynfgfidttayt
gsitytavstkqgfwewtstgyavgsgtfkstsidgiadtgttllylpatvvsaywaqvs
gakssssvggyvfpcsatlpsftfgvgsarivipgdyidfgpistgssscfggiqssagi
ginifgdvalkaafvvfngattptlgfask

Timeline for d1epoe_:

• d1epoe_ first appeared (with stable ids) in SCOP 1.55
  
• d1epoe_ appears in SCOPe 2.05
  
• d1epoe_ appears in SCOPe 2.07
  
• d1epoe_ appears in the current release, SCOPe 2.08