SCOPe 2.04: Domain d1er8e_: 1er8 E:

Lineage for d1er8e_ (1er8 E:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.50: Acid proteases [50629] (1 superfamily)
   barrel, closed; n=6, S=10, complex topology

4. Superfamily b.50.1: Acid proteases [50630] (4 families)

5. Family b.50.1.2: Pepsin-like [50646] (11 proteins)
   duplication: consists of two similar barrel domains
   N-terminal: barrel, partly opened; n*=6, S*=10

6. Protein Endothiapepsin [50647] (1 species)

7. Species Chestnut blight fungus (Endothia parasitica) [TaxId:5116] [50648] (47 PDB entries)

8. Domain d1er8e_: 1er8 E: [26789]

Details for d1er8e_

PDB Entry: 1er8, 2 Å

PDB Description: the active site of aspartic proteinases

PDB Compounds: (E:) endothiapepsin

SCOPe Domain Sequences for d1er8e_:

Sequence; same for both SEQRES and ATOM records:

>d1er8e_ b.50.1.2 (E:) Endothiapepsin {Chestnut blight fungus (Endothia parasitica) [TaxId: 5116]}
stgsatttpidslddayitpvqigtpaqtlnldfdtgssdlwvfssettasevdgqtiyt
psksttakllsgatwsisygdgssssgdvytdtvsvggltvtgqavesakkvsssfteds
tidgllglafstlntvsptqqktffdnakasldspvftadlgyhapgtynfgfidttayt
gsitytavstkqgfwewtstgyavgsgtfkstsidgiadtgttllylpatvvsaywaqvs
gakssssvggyvfpcsatlpsftfgvgsarivipgdyidfgpistgssscfggiqssagi
ginifgdvalkaafvvfngattptlgfask

Timeline for d1er8e_:

• d1er8e_ first appeared (with stable ids) in SCOP 1.55
  
• d1er8e_ appears in SCOPe 2.03
  
• d1er8e_ appears in SCOPe 2.05
  
• d1er8e_ appears in the current release, SCOPe 2.08