Lineage for d1er8e_ (1er8 E:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2799129Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 2799130Superfamily b.50.1: Acid proteases [50630] (4 families) (S)
  5. 2800798Family b.50.1.2: Pepsin-like [50646] (11 proteins)
    duplication: consists of two similar barrel domains
    N-terminal: barrel, partly opened; n*=6, S*=10
  6. 2801552Protein Endothiapepsin [50647] (1 species)
  7. 2801553Species Chestnut blight fungus (Endothia parasitica) [TaxId:5116] [50648] (538 PDB entries)
  8. 2802079Domain d1er8e_: 1er8 E: [26789]

Details for d1er8e_

PDB Entry: 1er8 (more details), 2 Å

PDB Description: the active site of aspartic proteinases
PDB Compounds: (E:) endothiapepsin

SCOPe Domain Sequences for d1er8e_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1er8e_ b.50.1.2 (E:) Endothiapepsin {Chestnut blight fungus (Endothia parasitica) [TaxId: 5116]}
stgsatttpidslddayitpvqigtpaqtlnldfdtgssdlwvfssettasevdgqtiyt
psksttakllsgatwsisygdgssssgdvytdtvsvggltvtgqavesakkvsssfteds
tidgllglafstlntvsptqqktffdnakasldspvftadlgyhapgtynfgfidttayt
gsitytavstkqgfwewtstgyavgsgtfkstsidgiadtgttllylpatvvsaywaqvs
gakssssvggyvfpcsatlpsftfgvgsarivipgdyidfgpistgssscfggiqssagi
ginifgdvalkaafvvfngattptlgfask

SCOPe Domain Coordinates for d1er8e_:

Click to download the PDB-style file with coordinates for d1er8e_.
(The format of our PDB-style files is described here.)

Timeline for d1er8e_: