Lineage for d1eedp_ (1eed P:)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.50: Acid proteases [50629] (1 superfamily) Superfamily b.50.1: Acid proteases [50630] (2 families) 
Family b.50.1.2: Pepsin-like [50646] (9 proteins) 
Protein Endothiapepsin [50647] (1 species) Species Chestnut blight fungus (Endothia parasitica) [TaxId:5116] [50648] (26 PDB entries) 
Domain d1eedp_: 1eed P: [26788]
Details for d1eedp_
PDB Entry: 1eed (more details), 2 Å
PDB Description: x-ray crystallographic analysis of inhibition of endothiapepsin by cyclohexyl renin inhibitors
SCOP Domain Sequences for d1eedp_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1eedp_ b.50.1.2 (P:) Endothiapepsin {Chestnut blight fungus (Endothia parasitica)}
stgsatttpidslddayitpvqigtpaqtlnldfdtgssdlwvfssettasevdgqtiyt
psksttakllsgatwsisygdgssssgdvytdtvsvggltvtgqavesakkvsssfteds
tidgllglafstlntvsptqqktffdnakasldspvftadlgyhapgtynfgfidttayt
gsitytavstkqgfwewtstgyavgsgtfkstsidgiadtgttllylpatvvsaywaqvs
gakssssvggyvfpcsatlpsftfgvgsarivipgdyidfgpistgssscfggiqssagi
ginifgdvalkaafvvfngattptlgfask
SCOP Domain Coordinates for d1eedp_:
Click to download the PDB-style file with coordinates for d1eedp_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1eedp_:
- d1eedp_ appears in SCOP 1.57
- d1eedp_ appears in the current release, SCOPe 2.08
View in 3D