Lineage for d5er2e_ (5er2 E:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 15694Fold b.50: Acid proteases [50629] (1 superfamily)
  4. 15695Superfamily b.50.1: Acid proteases [50630] (2 families) (S)
  5. 15989Family b.50.1.2: Pepsin-like [50646] (9 proteins)
  6. 16059Protein Endothiapepsin [50647] (1 species)
  7. 16060Species Chestnut blight fungus (Endothia parasitica) [TaxId:5116] [50648] (26 PDB entries)
  8. 16065Domain d5er2e_: 5er2 E: [26783]

Details for d5er2e_

PDB Entry: 5er2 (more details), 1.8 Å

PDB Description: high-resolution x-ray diffraction study of the complex between endothiapepsin and an oligopeptide inhibitor. the analysis of the inhibitor binding and description of the rigid body shift in the enzyme

SCOP Domain Sequences for d5er2e_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5er2e_ b.50.1.2 (E:) Endothiapepsin {Chestnut blight fungus (Endothia parasitica)}
stgsatttpidslddayitpvqigtpaqtlnldfdtgssdlwvfssettasevdgqtiyt
psksttakllsgatwsisygdgssssgdvytdtvsvggltvtgqavesakkvsssfteds
tidgllglafstlntvsptqqktffdnakasldspvftadlgyhapgtynfgfidttayt
gsitytavstkqgfwewtstgyavgsgtfkstsidgiadtgttllylpatvvsaywaqvs
gakssssvggyvfpcsatlpsftfgvgsarivipgdyidfgpistgssscfggiqssagi
ginifgdvalkaafvvfngattptlgfask

SCOP Domain Coordinates for d5er2e_:

Click to download the PDB-style file with coordinates for d5er2e_.
(The format of our PDB-style files is described here.)

Timeline for d5er2e_: