SCOPe 2.06: Domain d2fmba_: 2fmb A:

Lineage for d2fmba_ (2fmb A:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.50: Acid proteases [50629] (1 superfamily)
   barrel, closed; n=6, S=10, complex topology

4. Superfamily b.50.1: Acid proteases [50630] (4 families)

5. Family b.50.1.1: Retroviral protease (retropepsin) [50631] (9 proteins)
   dimer of identical mono-domain chains, each containing (6,10) barrel

6. Protein EIAV protease [50644] (1 species)

7. Species Equine infectious anemia virus [TaxId:11665] [50645] (2 PDB entries)

8. Domain d2fmba_: 2fmb A: [26778]
   complexed with lp1

Details for d2fmba_

PDB Entry: 2fmb, 1.8 Å

PDB Description: eiav protease complexed with an inhibitor lp-130

PDB Compounds: (A:) equine infectious anemia virus protease

SCOPe Domain Sequences for d2fmba_:

Sequence; same for both SEQRES and ATOM records:

>d2fmba_ b.50.1.1 (A:) EIAV protease {Equine infectious anemia virus [TaxId: 11665]}
vtynlekrpttivlindtplnvlldtgadtsvlttahynrlkyrgrkyqgtgiggvggnv
etfstpvtikkkgrhiktrmlvadipvtilgrdilqdlgaklvl

Timeline for d2fmba_:

• d2fmba_ first appeared (with stable ids) in SCOP 1.55, called d2fmb__
  
• d2fmba_ appears in SCOPe 2.05
  
• d2fmba_ appears in SCOPe 2.07
  
• d2fmba_ appears in the current release, SCOPe 2.08