Lineage for d2fmba_ (2fmb A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1796116Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 1796117Superfamily b.50.1: Acid proteases [50630] (4 families) (S)
  5. 1796118Family b.50.1.1: Retroviral protease (retropepsin) [50631] (9 proteins)
    dimer of identical mono-domain chains, each containing (6,10) barrel
  6. 1796119Protein EIAV protease [50644] (1 species)
  7. 1796120Species Equine infectious anemia virus [TaxId:11665] [50645] (2 PDB entries)
  8. 1796122Domain d2fmba_: 2fmb A: [26778]
    complexed with lp1

Details for d2fmba_

PDB Entry: 2fmb (more details), 1.8 Å

PDB Description: eiav protease complexed with an inhibitor lp-130
PDB Compounds: (A:) equine infectious anemia virus protease

SCOPe Domain Sequences for d2fmba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fmba_ b.50.1.1 (A:) EIAV protease {Equine infectious anemia virus [TaxId: 11665]}
vtynlekrpttivlindtplnvlldtgadtsvlttahynrlkyrgrkyqgtgiggvggnv
etfstpvtikkkgrhiktrmlvadipvtilgrdilqdlgaklvl

SCOPe Domain Coordinates for d2fmba_:

Click to download the PDB-style file with coordinates for d2fmba_.
(The format of our PDB-style files is described here.)

Timeline for d2fmba_: