SCOP 1.63: Domain d2fmb__: 2fmb -

Lineage for d2fmb__ (2fmb -)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.50: Acid proteases [50629] (1 superfamily)
   barrel, closed; n=6, S=10, complex topology

4. Superfamily b.50.1: Acid proteases [50630] (2 families)

5. Family b.50.1.1: Retroviral protease (retropepsin) [50631] (8 proteins)
   dimer of identical mono-domain chains, each containing (6,10) barrel

6. Protein EIAV protease [50644] (1 species)

7. Species Equine infectious anemia virus [TaxId:11665] [50645] (2 PDB entries)

8. Domain d2fmb__: 2fmb - [26778]
   complexed with lp2; mutant

Details for d2fmb__

PDB Entry: 2fmb, 1.8 Å

PDB Description: eiav protease complexed with an inhibitor lp-130

SCOP Domain Sequences for d2fmb__:

Sequence; same for both SEQRES and ATOM records:

>d2fmb__ b.50.1.1 (-) EIAV protease {Equine infectious anemia virus}
vtynlekrpttivlindtplnvlldtgadtsvlttahynrlkyrgrkyqgtgiggvggnv
etfstpvtikkkgrhiktrmlvadipvtilgrdilqdlgaklvl

Timeline for d2fmb__:

• d2fmb__ first appeared (with stable ids) in SCOP 1.55
  
• d2fmb__ appears in SCOP 1.61
  
• d2fmb__ appears in SCOP 1.65
  
• d2fmb__ appears in the current release, SCOPe 2.08, called d2fmba_