Lineage for d1fmb__ (1fmb -)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 112553Fold b.50: Acid proteases [50629] (1 superfamily)
  4. 112554Superfamily b.50.1: Acid proteases [50630] (2 families) (S)
  5. 112555Family b.50.1.1: Retroviral protease (retropepsin) [50631] (7 proteins)
  6. 112556Protein EIAV protease [50644] (1 species)
  7. 112557Species Equine infectious anemia virus [TaxId:11665] [50645] (2 PDB entries)
  8. 112558Domain d1fmb__: 1fmb - [26777]

Details for d1fmb__

PDB Entry: 1fmb (more details), 1.8 Å

PDB Description: eiav protease complexed with the inhibitor hby-793

SCOP Domain Sequences for d1fmb__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fmb__ b.50.1.1 (-) EIAV protease {Equine infectious anemia virus}
vtynlekrpttivlindtplnvlldtgadtsvlttahynrlkyrgrkyqgtgiggvggnv
etfstpvtikkkgrhiktrmlvadipvtilgrdilqdlgaklvl

SCOP Domain Coordinates for d1fmb__:

Click to download the PDB-style file with coordinates for d1fmb__.
(The format of our PDB-style files is described here.)

Timeline for d1fmb__: