Lineage for d1mvpa_ (1mvp A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2058814Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 2058815Superfamily b.50.1: Acid proteases [50630] (4 families) (S)
  5. 2058816Family b.50.1.1: Retroviral protease (retropepsin) [50631] (9 protein domains)
    dimer of identical mono-domain chains, each containing (6,10) barrel
  6. 2060028Protein Myeloblastosis-associated viral protease [50642] (1 species)
  7. 2060029Species Avian myeloblastosis associated virus [TaxId:11960] [50643] (1 PDB entry)
  8. 2060030Domain d1mvpa_: 1mvp A: [26775]

Details for d1mvpa_

PDB Entry: 1mvp (more details), 2.2 Å

PDB Description: structural studies of the retroviral proteinase from avian myeloblastosis associated virus
PDB Compounds: (A:) myeloblastosis associated viral protease

SCOPe Domain Sequences for d1mvpa_:

Sequence, based on SEQRES records: (download)

>d1mvpa_ b.50.1.1 (A:) Myeloblastosis-associated viral protease {Avian myeloblastosis associated virus [TaxId: 11960]}
lamtmehkdrplvrviltntgshpvkqrsvyitalldsgaditiiseedwptdwpvmeaa
npqihgigggipmrksrdmievgvinrdgslerplllfpavamvrgsilgrdclqglglr
ltnl

Sequence, based on observed residues (ATOM records): (download)

>d1mvpa_ b.50.1.1 (A:) Myeloblastosis-associated viral protease {Avian myeloblastosis associated virus [TaxId: 11960]}
lamtmehkdrplvrviltntgshpvkqrsvyitalldsgaditiiseedwptdwpvmeap
mrksrdmievgvinrdgslerplllfpavamvrgsilgrdclqglglrltnl

SCOPe Domain Coordinates for d1mvpa_:

Click to download the PDB-style file with coordinates for d1mvpa_.
(The format of our PDB-style files is described here.)

Timeline for d1mvpa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1mvpb_