![]() | Class b: All beta proteins [48724] (141 folds) |
![]() | Fold b.50: Acid proteases [50629] (1 superfamily) barrel, closed; n=6, S=10, complex topology |
![]() | Superfamily b.50.1: Acid proteases [50630] (2 families) ![]() |
![]() | Family b.50.1.1: Retroviral protease (retropepsin) [50631] (8 proteins) dimer of identical mono-domain chains, each containing (6,10) barrel |
![]() | Protein Rous sarcoma virus protease [50640] (1 species) |
![]() | Species Rous sarcoma virus, strain pr-C [TaxId:11886] [50641] (2 PDB entries) |
![]() | Domain d1baib_: 1bai B: [26774] complexed with nh2 |
PDB Entry: 1bai (more details), 2.4 Å
SCOP Domain Sequences for d1baib_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1baib_ b.50.1.1 (B:) Rous sarcoma virus protease {Rous sarcoma virus, strain pr-C} lamtmehkdrplvrviltntgshpvkqrsvyitalldtgaddtviseedwptdwpvmeaa npqihgigggipvrksrdmielgvinrdgslerplllfplvamtpvnilgrdclqglglr ltnl
Timeline for d1baib_: