Lineage for d1baib_ (1bai B:)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 231370Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 231371Superfamily b.50.1: Acid proteases [50630] (2 families) (S)
  5. 231372Family b.50.1.1: Retroviral protease (retropepsin) [50631] (8 proteins)
    dimer of identical mono-domain chains, each containing (6,10) barrel
  6. 231735Protein Rous sarcoma virus protease [50640] (1 species)
  7. 231736Species Rous sarcoma virus, strain pr-C [TaxId:11886] [50641] (2 PDB entries)
  8. 231740Domain d1baib_: 1bai B: [26774]
    complexed with nh2

Details for d1baib_

PDB Entry: 1bai (more details), 2.4 Å

PDB Description: Crystal structure of Rous sarcoma virus protease in complex with inhibitor

SCOP Domain Sequences for d1baib_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1baib_ b.50.1.1 (B:) Rous sarcoma virus protease {Rous sarcoma virus, strain pr-C}
lamtmehkdrplvrviltntgshpvkqrsvyitalldtgaddtviseedwptdwpvmeaa
npqihgigggipvrksrdmielgvinrdgslerplllfplvamtpvnilgrdclqglglr
ltnl

SCOP Domain Coordinates for d1baib_:

Click to download the PDB-style file with coordinates for d1baib_.
(The format of our PDB-style files is described here.)

Timeline for d1baib_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1baia_