SCOP 1.63: Domain d1baia_: 1bai A:

Lineage for d1baia_ (1bai A:)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.50: Acid proteases [50629] (1 superfamily)
   barrel, closed; n=6, S=10, complex topology

4. Superfamily b.50.1: Acid proteases [50630] (2 families)

5. Family b.50.1.1: Retroviral protease (retropepsin) [50631] (8 proteins)
   dimer of identical mono-domain chains, each containing (6,10) barrel

6. Protein Rous sarcoma virus protease [50640] (1 species)

7. Species Rous sarcoma virus, strain pr-C [TaxId:11886] [50641] (2 PDB entries)

8. Domain d1baia_: 1bai A: [26773]

Details for d1baia_

PDB Entry: 1bai, 2.4 Å

PDB Description: Crystal structure of Rous sarcoma virus protease in complex with inhibitor

SCOP Domain Sequences for d1baia_:

Sequence; same for both SEQRES and ATOM records:

>d1baia_ b.50.1.1 (A:) Rous sarcoma virus protease {Rous sarcoma virus, strain pr-C}
lamtmehkdrplvrviltntgshpvkqrsvyitalldtgaddtviseedwptdwpvmeaa
npqihgigggipvrksrdmielgvinrdgslerplllfplvamtpvnilgrdclqglglr
ltnl

Timeline for d1baia_:

• d1baia_ first appeared (with stable ids) in SCOP 1.55
  
• d1baia_ appears in SCOP 1.61
  
• d1baia_ appears in SCOP 1.65
  
• d1baia_ appears in the current release, SCOPe 2.08