Class b: All beta proteins [48724] (119 folds) |
Fold b.50: Acid proteases [50629] (1 superfamily) barrel, closed; n=6, S=10, complex topology |
Superfamily b.50.1: Acid proteases [50630] (2 families) |
Family b.50.1.1: Retroviral protease (retropepsin) [50631] (8 proteins) dimer of identical mono-domain chains, each containing (6,10) barrel |
Protein Rous sarcoma virus protease [50640] (1 species) |
Species Rous sarcoma virus, strain pr-C [TaxId:11886] [50641] (2 PDB entries) |
Domain d1baia_: 1bai A: [26773] |
PDB Entry: 1bai (more details), 2.4 Å
SCOP Domain Sequences for d1baia_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1baia_ b.50.1.1 (A:) Rous sarcoma virus protease {Rous sarcoma virus, strain pr-C} lamtmehkdrplvrviltntgshpvkqrsvyitalldtgaddtviseedwptdwpvmeaa npqihgigggipvrksrdmielgvinrdgslerplllfplvamtpvnilgrdclqglglr ltnl
Timeline for d1baia_: