Lineage for d1baia_ (1bai A:)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.50: Acid proteases [50629] (1 superfamily) Superfamily b.50.1: Acid proteases [50630] (2 families) 
Family b.50.1.1: Retroviral protease (retropepsin) [50631] (7 proteins) 
Protein Rous sarcoma virus protease [50640] (1 species) Species Rous sarcoma virus, strain pr-C [TaxId:11886] [50641] (2 PDB entries) 
Domain d1baia_: 1bai A: [26773]
Details for d1baia_
PDB Entry: 1bai (more details), 2.4 Å
PDB Description: Crystal structure of Rous sarcoma virus protease in complex with inhibitor
SCOP Domain Sequences for d1baia_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1baia_ b.50.1.1 (A:) Rous sarcoma virus protease {Rous sarcoma virus, strain pr-C}
lamtmehkdrplvrviltntgshpvkqrsvyitalldtgaddtviseedwptdwpvmeaa
npqihgigggipvrksrdmielgvinrdgslerplllfplvamtpvnilgrdclqglglr
ltnl
SCOP Domain Coordinates for d1baia_:
Click to download the PDB-style file with coordinates for d1baia_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1baia_:
- d1baia_ appears in SCOP 1.57
- d1baia_ appears in the current release, SCOPe 2.08
View in 3D
