Lineage for d1baia_ (1bai A:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 15694Fold b.50: Acid proteases [50629] (1 superfamily)
  4. 15695Superfamily b.50.1: Acid proteases [50630] (2 families) (S)
  5. 15696Family b.50.1.1: Retroviral protease (retropepsin) [50631] (7 proteins)
  6. 15966Protein Rous sarcoma virus protease [50640] (1 species)
  7. 15967Species Rous sarcoma virus, strain pr-C [TaxId:11886] [50641] (2 PDB entries)
  8. 15970Domain d1baia_: 1bai A: [26773]

Details for d1baia_

PDB Entry: 1bai (more details), 2.4 Å

PDB Description: Crystal structure of Rous sarcoma virus protease in complex with inhibitor

SCOP Domain Sequences for d1baia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1baia_ b.50.1.1 (A:) Rous sarcoma virus protease {Rous sarcoma virus, strain pr-C}
lamtmehkdrplvrviltntgshpvkqrsvyitalldtgaddtviseedwptdwpvmeaa
npqihgigggipvrksrdmielgvinrdgslerplllfplvamtpvnilgrdclqglglr
ltnl

SCOP Domain Coordinates for d1baia_:

Click to download the PDB-style file with coordinates for d1baia_.
(The format of our PDB-style files is described here.)

Timeline for d1baia_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1baib_