Lineage for d2rspb_ (2rsp B:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2391025Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 2391026Superfamily b.50.1: Acid proteases [50630] (4 families) (S)
  5. 2391027Family b.50.1.1: Retroviral protease (retropepsin) [50631] (9 protein domains)
    dimer of identical mono-domain chains, each containing (6,10) barrel
  6. 2392297Protein Rous sarcoma virus protease [50640] (1 species)
  7. 2392298Species Rous sarcoma virus, strain pr-C [TaxId:11886] [50641] (2 PDB entries)
  8. 2392300Domain d2rspb_: 2rsp B: [26772]

Details for d2rspb_

PDB Entry: 2rsp (more details), 2 Å

PDB Description: structure of the aspartic protease from rous sarcoma retrovirus refined at 2 angstroms resolution
PDB Compounds: (B:) rsv protease

SCOPe Domain Sequences for d2rspb_:

Sequence, based on SEQRES records: (download)

>d2rspb_ b.50.1.1 (B:) Rous sarcoma virus protease {Rous sarcoma virus, strain pr-C [TaxId: 11886]}
lamtmehkdrplvrviltntgshpvkqrsvyitalldsgaditiiseedwptdwpvmeaa
npqihgigggipmrksrdmielgvinrdgslerplllfpavamvrgsilgrdclqglglr
ltnl

Sequence, based on observed residues (ATOM records): (download)

>d2rspb_ b.50.1.1 (B:) Rous sarcoma virus protease {Rous sarcoma virus, strain pr-C [TaxId: 11886]}
lamtmehkdrplvrviltntgshpvkqrsvyitalldsgaditiiseedwptdwpvmegi
pmrksrdmielgvinrdgslerplllfpavamvrgsilgrdclqglglrltnl

SCOPe Domain Coordinates for d2rspb_:

Click to download the PDB-style file with coordinates for d2rspb_.
(The format of our PDB-style files is described here.)

Timeline for d2rspb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2rspa_