SCOPe 2.06: Domain d2fivb_: 2fiv B:

Lineage for d2fivb_ (2fiv B:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.50: Acid proteases [50629] (1 superfamily)
   barrel, closed; n=6, S=10, complex topology

4. Superfamily b.50.1: Acid proteases [50630] (4 families)

5. Family b.50.1.1: Retroviral protease (retropepsin) [50631] (9 proteins)
   dimer of identical mono-domain chains, each containing (6,10) barrel

6. Protein Feline immunodeficiency virus (FIV) protease [50638] (1 species)

7. Species Feline immunodeficiency virus [TaxId:11673] [50639] (7 PDB entries)

8. Domain d2fivb_: 2fiv B: [26767]
   complexed with so4

Details for d2fivb_

PDB Entry: 2fiv, 2 Å

PDB Description: crystal structure of feline immunodeficiency virus protease complexed with a substrate

PDB Compounds: (B:) feline immunodeficiency virus protease

SCOPe Domain Sequences for d2fivb_:

Sequence; same for both SEQRES and ATOM records:

>d2fivb_ b.50.1.1 (B:) Feline immunodeficiency virus (FIV) protease {Feline immunodeficiency virus [TaxId: 11673]}
vgttttlekrpeilifvngypikfllntgaditilnrrdfqvknsiengrqnmigvgggk
rgtnyinvhleirdenyktqcifgnvcvlednsliqpllgrdnmikfnirlvm

Timeline for d2fivb_:

• d2fivb_ first appeared (with stable ids) in SCOP 1.55
  
• d2fivb_ appears in SCOPe 2.05
  
• d2fivb_ appears in SCOPe 2.07
  
• d2fivb_ appears in the current release, SCOPe 2.08