Lineage for d2fivb_ (2fiv B:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 15694Fold b.50: Acid proteases [50629] (1 superfamily)
  4. 15695Superfamily b.50.1: Acid proteases [50630] (2 families) (S)
  5. 15696Family b.50.1.1: Retroviral protease (retropepsin) [50631] (7 proteins)
  6. 15701Protein Feline immunodeficiency virus (FIV) protease [50638] (1 species)
  7. 15702Species Feline immunodeficiency virus [TaxId:11673] [50639] (7 PDB entries)
  8. 15707Domain d2fivb_: 2fiv B: [26767]

Details for d2fivb_

PDB Entry: 2fiv (more details), 2 Å

PDB Description: crystal structure of feline immunodeficiency virus protease complexed with a substrate

SCOP Domain Sequences for d2fivb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fivb_ b.50.1.1 (B:) Feline immunodeficiency virus (FIV) protease {Feline immunodeficiency virus}
vgttttlekrpeilifvngypikfllntgaditilnrrdfqvknsiengrqnmigvgggk
rgtnyinvhleirdenyktqcifgnvcvlednsliqpllgrdnmikfnirlvm

SCOP Domain Coordinates for d2fivb_:

Click to download the PDB-style file with coordinates for d2fivb_.
(The format of our PDB-style files is described here.)

Timeline for d2fivb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2fiva_