Lineage for d2fiva_ (2fiv A:)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 231370Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 231371Superfamily b.50.1: Acid proteases [50630] (2 families) (S)
  5. 231372Family b.50.1.1: Retroviral protease (retropepsin) [50631] (8 proteins)
    dimer of identical mono-domain chains, each containing (6,10) barrel
  6. 231377Protein Feline immunodeficiency virus (FIV) protease [50638] (1 species)
  7. 231378Species Feline immunodeficiency virus [TaxId:11673] [50639] (7 PDB entries)
  8. 231386Domain d2fiva_: 2fiv A: [26766]

Details for d2fiva_

PDB Entry: 2fiv (more details), 2 Å

PDB Description: crystal structure of feline immunodeficiency virus protease complexed with a substrate

SCOP Domain Sequences for d2fiva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fiva_ b.50.1.1 (A:) Feline immunodeficiency virus (FIV) protease {Feline immunodeficiency virus}
vgttttlekrpeilifvngypikfllntgaditilnrrdfqvknsiengrqnmigvgggk
rgtnyinvhleirdenyktqcifgnvcvlednsliqpllgrdnmikfnirlvm

SCOP Domain Coordinates for d2fiva_:

Click to download the PDB-style file with coordinates for d2fiva_.
(The format of our PDB-style files is described here.)

Timeline for d2fiva_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2fivb_