Lineage for d4fiv__ (4fiv -)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 299835Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 299836Superfamily b.50.1: Acid proteases [50630] (2 families) (S)
  5. 299837Family b.50.1.1: Retroviral protease (retropepsin) [50631] (8 proteins)
    dimer of identical mono-domain chains, each containing (6,10) barrel
  6. 299842Protein Feline immunodeficiency virus (FIV) protease [50638] (1 species)
  7. 299843Species Feline immunodeficiency virus [TaxId:11673] [50639] (7 PDB entries)
  8. 299844Domain d4fiv__: 4fiv - [26762]
    complexed with 1ni

Details for d4fiv__

PDB Entry: 4fiv (more details), 1.8 Å

PDB Description: fiv protease complexed with an inhibitor lp-130

SCOP Domain Sequences for d4fiv__:

Sequence; same for both SEQRES and ATOM records: (download)

>d4fiv__ b.50.1.1 (-) Feline immunodeficiency virus (FIV) protease {Feline immunodeficiency virus}
vgttttlekrpeilifvngypikflldtgaditilnrrdfqvknsiengrqnmigvgggk
rgtnyinvhleirdenyktqcifgnvcvlednsliqpllgrdnmikfnirlvm

SCOP Domain Coordinates for d4fiv__:

Click to download the PDB-style file with coordinates for d4fiv__.
(The format of our PDB-style files is described here.)

Timeline for d4fiv__: