Lineage for d4fiv__ (4fiv -)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 168884Fold b.50: Acid proteases [50629] (1 superfamily)
  4. 168885Superfamily b.50.1: Acid proteases [50630] (2 families) (S)
  5. 168886Family b.50.1.1: Retroviral protease (retropepsin) [50631] (7 proteins)
  6. 168891Protein Feline immunodeficiency virus (FIV) protease [50638] (1 species)
  7. 168892Species Feline immunodeficiency virus [TaxId:11673] [50639] (7 PDB entries)
  8. 168893Domain d4fiv__: 4fiv - [26762]

Details for d4fiv__

PDB Entry: 4fiv (more details), 1.8 Å

PDB Description: fiv protease complexed with an inhibitor lp-130

SCOP Domain Sequences for d4fiv__:

Sequence; same for both SEQRES and ATOM records: (download)

>d4fiv__ b.50.1.1 (-) Feline immunodeficiency virus (FIV) protease {Feline immunodeficiency virus}
vgttttlekrpeilifvngypikflldtgaditilnrrdfqvknsiengrqnmigvgggk
rgtnyinvhleirdenyktqcifgnvcvlednsliqpllgrdnmikfnirlvm

SCOP Domain Coordinates for d4fiv__:

Click to download the PDB-style file with coordinates for d4fiv__.
(The format of our PDB-style files is described here.)

Timeline for d4fiv__: