Lineage for d4fiv__ (4fiv -)
- Root: SCOP 1.57
Class b: All beta proteins [48724] (104 folds) 
Fold b.50: Acid proteases [50629] (1 superfamily) Superfamily b.50.1: Acid proteases [50630] (2 families) 
Family b.50.1.1: Retroviral protease (retropepsin) [50631] (7 proteins) 
Protein Feline immunodeficiency virus (FIV) protease [50638] (1 species) Species Feline immunodeficiency virus [TaxId:11673] [50639] (7 PDB entries) 
Domain d4fiv__: 4fiv - [26762]
Details for d4fiv__
PDB Entry: 4fiv (more details), 1.8 Å
PDB Description: fiv protease complexed with an inhibitor lp-130
SCOP Domain Sequences for d4fiv__:
Sequence; same for both SEQRES and ATOM records: (download)
>d4fiv__ b.50.1.1 (-) Feline immunodeficiency virus (FIV) protease {Feline immunodeficiency virus}
vgttttlekrpeilifvngypikflldtgaditilnrrdfqvknsiengrqnmigvgggk
rgtnyinvhleirdenyktqcifgnvcvlednsliqpllgrdnmikfnirlvm
SCOP Domain Coordinates for d4fiv__:
Click to download the PDB-style file with coordinates for d4fiv__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4fiv__:
- d4fiv__ first appeared (with stable ids) in SCOP 1.55
- d4fiv__ appears in SCOP 1.59
- d4fiv__ appears in the current release, SCOPe 2.08, called d4fiva_
View in 3D