SCOPe 2.05: Domain d1tcwa_: 1tcw A:

Lineage for d1tcwa_ (1tcw A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.50: Acid proteases [50629] (1 superfamily)
   barrel, closed; n=6, S=10, complex topology

4. Superfamily b.50.1: Acid proteases [50630] (4 families)

5. Family b.50.1.1: Retroviral protease (retropepsin) [50631] (9 proteins)
   dimer of identical mono-domain chains, each containing (6,10) barrel

6. Protein Simian immunodeficiency virus (SIV) protease [50636] (1 species)

7. Species Simian immunodeficiency virus, different strains [TaxId:11723] [50637] (7 PDB entries)

8. Domain d1tcwa_: 1tcw A: [26760]
   protein/DNA complex; protein/RNA complex; complexed with im1

Details for d1tcwa_

PDB Entry: 1tcw, 2.4 Å

PDB Description: siv protease complexed with inhibitor sb203386

PDB Compounds: (A:) siv protease

SCOPe Domain Sequences for d1tcwa_:

Sequence; same for both SEQRES and ATOM records:

>d1tcwa_ b.50.1.1 (A:) Simian immunodeficiency virus (SIV) protease {Simian immunodeficiency virus, different strains [TaxId: 11723]}
pqfslwrrpvvtahiegqpvevlldtgaddsivtgielgphytpkivggiggfintkeyk
nvkievlgkrikgtimtgdtpinifgrnlltalgmslnl

Timeline for d1tcwa_:

• d1tcwa_ first appeared (with stable ids) in SCOP 1.55
  
• d1tcwa_ appears in SCOPe 2.04
  
• d1tcwa_ appears in SCOPe 2.06
  
• d1tcwa_ appears in the current release, SCOPe 2.08