Lineage for d1sivb_ (1siv B:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 15694Fold b.50: Acid proteases [50629] (1 superfamily)
  4. 15695Superfamily b.50.1: Acid proteases [50630] (2 families) (S)
  5. 15696Family b.50.1.1: Retroviral protease (retropepsin) [50631] (7 proteins)
  6. 15972Protein Simian immunodeficiency virus (SIV) protease [50636] (1 species)
  7. 15973Species Simian immunodeficiency virus, different strains [TaxId:11723] [50637] (10 PDB entries)
  8. 15986Domain d1sivb_: 1siv B: [26759]

Details for d1sivb_

PDB Entry: 1siv (more details), 2.5 Å

PDB Description: three-dimensional structure of a siv protease(slash)inhibitor complex. implications for the design of hiv-1 and hiv-2 protease inhibitors

SCOP Domain Sequences for d1sivb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sivb_ b.50.1.1 (B:) Simian immunodeficiency virus (SIV) protease {Simian immunodeficiency virus, different strains}
pqfslwrrpvvtahiegqpvevlldtgaddsivtgielgphytpkivggiggfintkeyk
nvkievlgkrikgtimtgdtpinifgrnlltalgmslnl

SCOP Domain Coordinates for d1sivb_:

Click to download the PDB-style file with coordinates for d1sivb_.
(The format of our PDB-style files is described here.)

Timeline for d1sivb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1siva_