Lineage for d4x04b_ (4x04 B:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1879042Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 1879043Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 1880254Family c.94.1.0: automated matches [191309] (1 protein)
    not a true family
  6. 1880255Protein automated matches [190039] (120 species)
    not a true protein
  7. 1880392Species Citrobacter koseri [TaxId:290338] [267974] (2 PDB entries)
  8. 1880394Domain d4x04b_: 4x04 B: [267586]
    automated match to d4mija_
    complexed with bdp, cl, mg

Details for d4x04b_

PDB Entry: 4x04 (more details), 2.5 Å

PDB Description: crystal structure of a trap periplasmic solute binding protein from citrobacter koseri (cko_04899, target efi-510094) with bound d- glucuronate
PDB Compounds: (B:) solute binding protein

SCOPe Domain Sequences for d4x04b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4x04b_ c.94.1.0 (B:) automated matches {Citrobacter koseri [TaxId: 290338]}
mqvikaadvhpqgypnvvavqkmgeklkqqtdgkleikvfpggvlgdekqmieqaqigai
dmirvsmapvaailpdievftlpyvfrdedhmhkiidgdigksigdkltnnpksrlvflg
wmdsgtrnlitknpvekpedlhgmkirvqgspvaldtlkdmgansvamgvsevfsgmqtg
vidgaennpptfvahnympvaknytlsghfitpemllyskvkwdkltadeqqkiltlare
aqfeqrklwdaynqealakmkaggvqfheidkayfvkatepvraqygekhqalmkaiadv
q

SCOPe Domain Coordinates for d4x04b_:

Click to download the PDB-style file with coordinates for d4x04b_.
(The format of our PDB-style files is described here.)

Timeline for d4x04b_: