Lineage for d4x04b1 (4x04 B:28-327)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2913607Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2913608Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2915150Family c.94.1.0: automated matches [191309] (1 protein)
    not a true family
  6. 2915151Protein automated matches [190039] (161 species)
    not a true protein
  7. 2915405Species Citrobacter koseri [TaxId:290338] [267974] (2 PDB entries)
  8. 2915407Domain d4x04b1: 4x04 B:28-327 [267586]
    Other proteins in same PDB: d4x04a2, d4x04b2, d4x04c2, d4x04d2
    automated match to d4mija_
    complexed with bdp, cl, mg

Details for d4x04b1

PDB Entry: 4x04 (more details), 2.5 Å

PDB Description: crystal structure of a trap periplasmic solute binding protein from citrobacter koseri (cko_04899, target efi-510094) with bound d- glucuronate
PDB Compounds: (B:) solute binding protein

SCOPe Domain Sequences for d4x04b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4x04b1 c.94.1.0 (B:28-327) automated matches {Citrobacter koseri [TaxId: 290338]}
qvikaadvhpqgypnvvavqkmgeklkqqtdgkleikvfpggvlgdekqmieqaqigaid
mirvsmapvaailpdievftlpyvfrdedhmhkiidgdigksigdkltnnpksrlvflgw
mdsgtrnlitknpvekpedlhgmkirvqgspvaldtlkdmgansvamgvsevfsgmqtgv
idgaennpptfvahnympvaknytlsghfitpemllyskvkwdkltadeqqkiltlarea
qfeqrklwdaynqealakmkaggvqfheidkayfvkatepvraqygekhqalmkaiadvq

SCOPe Domain Coordinates for d4x04b1:

Click to download the PDB-style file with coordinates for d4x04b1.
(The format of our PDB-style files is described here.)

Timeline for d4x04b1: