Lineage for d1siva_ (1siv A:)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 231370Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 231371Superfamily b.50.1: Acid proteases [50630] (2 families) (S)
  5. 231372Family b.50.1.1: Retroviral protease (retropepsin) [50631] (8 proteins)
    dimer of identical mono-domain chains, each containing (6,10) barrel
  6. 231741Protein Simian immunodeficiency virus (SIV) protease [50636] (1 species)
  7. 231742Species Simian immunodeficiency virus, different strains [TaxId:11723] [50637] (14 PDB entries)
  8. 231762Domain d1siva_: 1siv A: [26758]

Details for d1siva_

PDB Entry: 1siv (more details), 2.5 Å

PDB Description: three-dimensional structure of a siv protease(slash)inhibitor complex. implications for the design of hiv-1 and hiv-2 protease inhibitors

SCOP Domain Sequences for d1siva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1siva_ b.50.1.1 (A:) Simian immunodeficiency virus (SIV) protease {Simian immunodeficiency virus, different strains}
pqfslwrrpvvtahiegqpvevlldtgaddsivtgielgphytpkivggiggfintkeyk
nvkievlgkrikgtimtgdtpinifgrnlltalgmslnl

SCOP Domain Coordinates for d1siva_:

Click to download the PDB-style file with coordinates for d1siva_.
(The format of our PDB-style files is described here.)

Timeline for d1siva_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1sivb_