SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d4wk6a1 (4wk6 A:5-246)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2090218Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2090219Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2094257Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2094258Protein automated matches [190069] (222 species)
    not a true protein
  7. 2096407Species Vibrio cholerae [TaxId:592313] [267996] (1 PDB entry)
  8. 2096408Domain d4wk6a1: 4wk6 A:5-246 [267579]
    Other proteins in same PDB: d4wk6a2, d4wk6b2, d4wk6c2, d4wk6d2
    automated match to d4ag3c_
    complexed with 1pe, ndp

Details for d4wk6a1

PDB Entry: 4wk6 (more details), 2.21 Å

PDB Description: crystal structure of 3-ketoacyl-(acyl-carrier-protein) reductase (fabg) (g141a) from vibrio cholerae in complex with nadph
PDB Compounds: (A:) 3-oxoacyl-[acyl-carrier protein] reductase

SCOPe Domain Sequences for d4wk6a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4wk6a1 c.2.1.0 (A:5-246) automated matches {Vibrio cholerae [TaxId: 592313]}
mnlegkvalvtgasrgigkaiaellaergakvigtatsesgaqaisdylgdngkgmalnv
tnpesieavlkaitdefggvdilvnnagitrdnllmrmkeeewsdimetnltsifrlska
vlrgmmkkrqgriinvasvvgtmgnagqanyaaakagvigftksmarevasrgvtvntva
pgfietdmtkalndeqrtatlaqvpagrlgdpreiasavaflaspeaayitgetlhvngg
my

SCOPe Domain Coordinates for d4wk6a1:

Click to download the PDB-style file with coordinates for d4wk6a1.
(The format of our PDB-style files is described here.)

Timeline for d4wk6a1:

  • d4wk6a1 first appeared in SCOPe 2.05, called d4wk6a_