Lineage for d4wgha_ (4wgh A:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2413227Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2415941Superfamily c.1.7: NAD(P)-linked oxidoreductase [51430] (2 families) (S)
  5. 2416428Family c.1.7.0: automated matches [191491] (1 protein)
    not a true family
  6. 2416429Protein automated matches [190793] (26 species)
    not a true protein
  7. 2416506Species Klebsiella pneumoniae [TaxId:573] [267995] (2 PDB entries)
  8. 2416507Domain d4wgha_: 4wgh A: [267577]
    automated match to d4pmja_
    complexed with act, nap

Details for d4wgha_

PDB Entry: 4wgh (more details), 1.8 Å

PDB Description: crystal structure of aldo/keto reductase from klebsiella pneumoniae in complex with nadp and acetate at 1.8 a resolution
PDB Compounds: (A:) aldehyde reductase

SCOPe Domain Sequences for d4wgha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4wgha_ c.1.7.0 (A:) automated matches {Klebsiella pneumoniae [TaxId: 573]}
vkktvrfgeqaavpaiglgtwymgehaaqrqqevaalragidhgltvidtaemyadggae
evvgqairglrdrvvlvskvypwhagkaamhracenslrrlqtdyldmyllhwrgdiplq
etveameklvaegkirrwgvsnldtedmqalwrtadgehcatnqvlyhlasrgieydllp
wcqqhslpvmaycplaqagrlrdglfqhsdiinmanargitvaqlllawvirhpgvlaip
kaasiehvvqnaaaldivlsgeelaqldrlypppqrknrldmv

SCOPe Domain Coordinates for d4wgha_:

Click to download the PDB-style file with coordinates for d4wgha_.
(The format of our PDB-style files is described here.)

Timeline for d4wgha_: