SCOP 1.63: Domain d1sip__: 1sip -

Lineage for d1sip__ (1sip -)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.50: Acid proteases [50629] (1 superfamily)
   barrel, closed; n=6, S=10, complex topology

4. Superfamily b.50.1: Acid proteases [50630] (2 families)

5. Family b.50.1.1: Retroviral protease (retropepsin) [50631] (8 proteins)
   dimer of identical mono-domain chains, each containing (6,10) barrel

6. Protein Simian immunodeficiency virus (SIV) protease [50636] (1 species)

7. Species Simian immunodeficiency virus, different strains [TaxId:11723] [50637] (14 PDB entries)

8. Domain d1sip__: 1sip - [26757]

Details for d1sip__

PDB Entry: 1sip, 2.3 Å

PDB Description: alternative native flap conformation revealed by 2.3 angstroms resolution structure of siv proteinase

SCOP Domain Sequences for d1sip__:

Sequence; same for both SEQRES and ATOM records:

>d1sip__ b.50.1.1 (-) Simian immunodeficiency virus (SIV) protease {Simian immunodeficiency virus, different strains}
pqfslwrrpvvtahiegqpvevlldtgaddsivtgielgphytpkivggiggfintkeyk
nveievlgkrirgtimtgdtpinifgrnlltalgmslnf

Timeline for d1sip__:

• d1sip__ first appeared (with stable ids) in SCOP 1.55
  
• d1sip__ appears in SCOP 1.61
  
• d1sip__ appears in SCOP 1.65
  
• d1sip__ appears in the current release, SCOPe 2.08, called d1sipa_